SMIM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38120

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMIM1 Antibody - BSA Free

SMIM1 Antibody

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] - Analysis in human testis and rectum tissues using NBP2-38120 antibody. Corresponding SMIM1 RNA-seq data are presented for the same tissues.
SMIM1 Antibody

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
SMIM1 Antibody

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
SMIM1 Antibody

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human tonsil shows no positivity in non-germinal center cells as expected.
SMIM1 Antibody

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -

Immunohistochemistry-Paraffin: SMIM1 Antibody [NBP2-38120] -Staining of human rectum shows no positivity in glandular cells as expected.

Applications for SMIM1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMIM1

Alternate Names

Small Integral Membrane Protein 1, Small Integral Membrane Protein 1 (Vel Blood Group), Vel, Vel Blood Group Antigen

Gene Symbol

SMIM1

UniProt

Additional SMIM1 Products

Product Documents for SMIM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMIM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMIM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMIM1 Antibody - BSA Free and earn rewards!

Have you used SMIM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SMIM1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: May I know whether this Ab can be used for FACS?

    A: Our antibody NBP2-38120 has not yet been tested in flow cytometry or FACS. It has only been validated for use in IHC with paraffin embedded tissues. Should you like to try this antibody in flow/FACS you can use our Innovator's Reward Program. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply purchase the product as normal and submit a review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...