Recombinant Human SNRP70 GST (N-Term) Protein

Novus Biologicals | Catalog # H00006625-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection, SDS-PAGE
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-122 of Human SNRP70

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGGDGYLAPENGYLMEAAPE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

39.05 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SNRP70 GST (N-Term) Protein

SDS-PAGE: Recombinant Human SNRP70 GST (N-Term) Protein [H00006625-P01]

SDS-PAGE: Recombinant Human SNRP70 GST (N-Term) Protein [H00006625-P01]

SDS-Page: Recombinant Human SNRP70 Protein [H00006625-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00006625-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: SNRP70

SNRP70( AAH00342, 1 a.a. - 123 a.a.) recombinant protein with GST.

Alternate Names

RNPU1ZU170K, RPU1U1AP, small nuclear ribonucleoprotein 70kDa (U1), Snp1, snRNP70, SNRP70U1 small nuclear ribonucleoprotein 70 kDa, U1 snRNP 70 kDa, U1-70Ksmall nuclear ribonucleoprotein 70kDa (RNP antigen), U1AP1, U1RNP

Gene Symbol

SNRNP70

Additional SNRP70 Products

Product Documents for Recombinant Human SNRP70 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human SNRP70 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human SNRP70 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human SNRP70 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human SNRP70 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human SNRP70 GST (N-Term) Protein

Showing  1 - 1 of 1 FAQ Showing All
  • Q: First of all, I need information about the purity of the product, then about it's formulation and availability. Also, are the prices as given on the web page?

    A: The purification method used was Glutathione Sepharose 4 Fast Flow. The notes we have about its buffer are as follows: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. The percent purity of the protein H00006625-P01 is unknown, because the manufacturer (Abnova) has not tested it. However, they are ISO certified. Regarding the price and availability of this product, please use our website to select your country, which will allow you to view the country specific pricing, availability and technical support information.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...