SNX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56957

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYE

Reactivity Notes

Mouse 84%, Rat 84%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNX1 Antibody - BSA Free

Western Blot: SNX1 Antibody [NBP2-56957]

Western Blot: SNX1 Antibody [NBP2-56957]

Western Blot: SNX1 Antibody [NBP2-56957] - Analysis using Anti-SNX1 antibody NBP2-56957 (A) shows similar pattern to independent antibody NBP2-13359 (B).
Immunocytochemistry/ Immunofluorescence: SNX1 Antibody [NBP2-56957]

Immunocytochemistry/ Immunofluorescence: SNX1 Antibody [NBP2-56957]

Immunocytochemistry/Immunofluorescence: SNX1 Antibody [NBP2-56957] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
SNX1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SNX1 Antibody - BSA Free [NBP2-56957] -

A pool of SNX1-positive membranes at vicinity of nascent autophagosomes.(A) Time-lapse images of HeLa cells expressing SNX1-GFP and DCFP1-RFP under starved conditions (stv., 15 min). Arrowheads indicate SNX1-GFP–positive tubules associated with DFPC1-RFP structures. Scale bars = 1 um. (B) HeLa cells expressing Sec61 beta -RFP (magenta) and DFCP1-GFP (yellow) were grown under starvation for 1 h, fixed and stained with anti-SNX1 (blue) antibodies and observed by confocal microscopy. Scale bar = 5 um. (B, C) Magnified area (×4.5) from confocal image (B), top panel, showing codistribution event between Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow) and 3D rendering view of magnified area, bottom panel, showing the surface of Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow). Scale bars = 1 um. (C, D) Quantification of SNX1 codistribution with DFCP1-GFP and Sec61 beta -RFP (ER)-positive domains per 100 um2 as illustrated in (C). Means +/- SEM, from three independent experiments; ***P < 0.001 in unpaired two-tailed t test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36585258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SNX1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SNX1 Antibody - BSA Free [NBP2-56957] -

A pool of SNX1-positive membranes at vicinity of nascent autophagosomes.(A) Time-lapse images of HeLa cells expressing SNX1-GFP and DCFP1-RFP under starved conditions (stv., 15 min). Arrowheads indicate SNX1-GFP–positive tubules associated with DFPC1-RFP structures. Scale bars = 1 um. (B) HeLa cells expressing Sec61 beta -RFP (magenta) and DFCP1-GFP (yellow) were grown under starvation for 1 h, fixed and stained with anti-SNX1 (blue) antibodies and observed by confocal microscopy. Scale bar = 5 um. (B, C) Magnified area (×4.5) from confocal image (B), top panel, showing codistribution event between Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow) and 3D rendering view of magnified area, bottom panel, showing the surface of Sec61 beta -RFP (magenta), SNX1 (blue), and DFCP1-GFP (yellow). Scale bars = 1 um. (C, D) Quantification of SNX1 codistribution with DFCP1-GFP and Sec61 beta -RFP (ER)-positive domains per 100 um2 as illustrated in (C). Means +/- SEM, from three independent experiments; ***P < 0.001 in unpaired two-tailed t test. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36585258), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SNX1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX1

SNX1 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms.

Alternate Names

HsT17379, MGC8664, SNX1Asorting nexin 1A, sorting nexin 1, sorting nexin-1, Vps5

Gene Symbol

SNX1

Additional SNX1 Products

Product Documents for SNX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SNX1 Antibody - BSA Free

Customer Reviews for SNX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX1 Antibody - BSA Free and earn rewards!

Have you used SNX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...