SNX18 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82361

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNX18 Antibody - BSA Free

Western Blot: SNX18 Antibody [NBP1-82361]

Western Blot: SNX18 Antibody [NBP1-82361]

Western Blot: SNX18 Antibody [NBP1-82361] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: SNX18 Antibody [NBP1-82361]

Immunocytochemistry/ Immunofluorescence: SNX18 Antibody [NBP1-82361]

Immunocytochemistry/Immunofluorescence: SNX18 Antibody [NBP1-82361] - Staining of human cell line A-431 shows localization to cytosol.
Western Blot: SNX18 Antibody [NBP1-82361]

Western Blot: SNX18 Antibody [NBP1-82361]

Western Blot: SNX18 Antibody [NBP1-82361] - Analysis in human cell line BEWO.
Western Blot: SNX18 Antibody [NBP1-82361]

Western Blot: SNX18 Antibody [NBP1-82361]

Western Blot: SNX18 Antibody [NBP1-82361] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
SNX18 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
SNX18 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
SNX18 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
SNX18 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Immunohistochemistry-Paraffin: SNX18 Antibody [NBP1-82361]

Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.

Applications for SNX18 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX18

SNX18 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. The specific function of this protein has not been determined.

Alternate Names

FLJ11997, FLJ61062, MGC150827, MGC150829, SH3 and PX domain-containing protein 3B, SH3PX2, SH3PXD3BFLJ32560, SNAG1, sorting nexin 18, sorting nexin associated golgi protein 1, sorting nexin-18, Sorting nexin-associated Golgi protein 1

Gene Symbol

SNX18

Additional SNX18 Products

Product Documents for SNX18 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNX18 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNX18 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX18 Antibody - BSA Free and earn rewards!

Have you used SNX18 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...