solute carrier family 22, member 18 antisense Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39093

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ELPGSEGMWENCPLGWVKKKASGTLAPLDFLLQRKRLWLWASEPVRPQPQGIHRFREARRQFCRMRGSRLTGGRKG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for solute carrier family 22, member 18 antisense Antibody - BSA Free

Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Western Blot: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunocytochemistry/ Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunocytochemistry/Immunofluorescence: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Staining in human duodenum and liver tissues using anti-SLC22A18AS antibody. Corresponding SLC22A18AS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093]

Immunohistochemistry-Paraffin: solute carrier family 22, member 18 antisense Antibody [NBP2-39093] - Staining of human liver shows low expression as expected.

Applications for solute carrier family 22, member 18 antisense Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: solute carrier family 22, member 18 antisense

Alternate Names

BWR1BSolute carrier family 22 member 18 antisense protein, BWSCR1BBeckwith-Wiedemann region 1B, ORCTL2Sbeckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein, organic cation transporter-like 2 antisense, Organic cation transporter-like protein 2 antisense protein, p27-BWR1Bp27-Beckwith-Wiedemann region 1 B, SLC22A1LSBeckwith-Wiedemann syndrome chromosome region 1, candidate b, solute carrier family 22 (organic cation transporter), member 18 antisense, solute carrier family 22 (organic cation transporter), member 1-like antisense, Solute carrier family 22 member 1-like antisense protein

Gene Symbol

SLC22A18AS

UniProt

Additional solute carrier family 22, member 18 antisense Products

Product Documents for solute carrier family 22, member 18 antisense Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for solute carrier family 22, member 18 antisense Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for solute carrier family 22, member 18 antisense Antibody - BSA Free

There are currently no reviews for this product. Be the first to review solute carrier family 22, member 18 antisense Antibody - BSA Free and earn rewards!

Have you used solute carrier family 22, member 18 antisense Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...