Somatostatin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93171

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human SST (NP_001039.1). TGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Somatostatin Antibody - BSA Free

Immunohistochemistry-Paraffin: Somatostatin Antibody - Azide and BSA Free [NBP2-93171]

Immunohistochemistry-Paraffin: Somatostatin Antibody - Azide and BSA Free [NBP2-93171]

Immunohistochemistry-Paraffin: Somatostatin Antibody [NBP2-93171] - Human appendix using Somatostatin (SST) antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Somatostatin Antibody - Azide and BSA Free [NBP2-93171]

Immunohistochemistry-Paraffin: Somatostatin Antibody - Azide and BSA Free [NBP2-93171]

Immunohistochemistry-Paraffin: Somatostatin Antibody [NBP2-93171] - Mouse pancreas using Somatostatin (SST) antibody at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Somatostatin Antibody - Azide and BSA Free

Western Blot: Somatostatin Antibody [NBP2-93171] -

Western Blot: Somatostatin Antibody [NBP2-93171] - analysis of Rat brain, using Somatostatin (SST) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Somatostatin Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Somatostatin Antibody - Azide and BSA Free [NBP2-93171] -

Immunocytochemistry/ Immunofluorescence: Somatostatin Antibody - Azide and BSA Free [NBP2-93171] - Immunofluorescence analysis of paraffin-embedded mouse pancreas using Somatostatin Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Somatostatin Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Somatostatin Antibody - Azide and BSA Free [NBP2-93171] -

Immunocytochemistry/ Immunofluorescence: Somatostatin Antibody - Azide and BSA Free [NBP2-93171] - Immunofluorescence analysis of paraffin-embedded rat pancreas using Somatostatin Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Somatostatin Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Somatostatin

The hormone somatostatin has active 14 aa and 28 aa forms that are produced by alternate cleavage of the single preproprotein encoded by this gene. Somatostatin is expressed throughout the body and inhibits the release of numerous secondary hormones by binding to high-affinity G-protein-coupled somatostatin receptors. This hormone is an important regulator of the endocrine system through its interactions with pituitary growth hormone, thyroid stimulating hormone, and most hormones of the gastrointestinal tract. Somatostatin also affects rates of neurotransmission in the central nervous system and proliferation of both normal and tumorigenic cells. (provided by RefSeq)

Alternate Names

SMST, SOM, SRIF, SST

Gene Symbol

SST

Additional Somatostatin Products

Product Documents for Somatostatin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Somatostatin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Somatostatin Antibody - BSA Free

Customer Reviews for Somatostatin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Somatostatin Antibody - BSA Free and earn rewards!

Have you used Somatostatin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...