SPANXB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84273

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SPANXB1. Peptide sequence: MPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELVNDHARE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SPANXB1 Antibody - BSA Free

Western Blot: SPANXB1 Antibody [NBP2-84273]

Western Blot: SPANXB1 Antibody [NBP2-84273]

Western Blot: SPANXB1 Antibody [NBP2-84273] - Host: Rabbit. Target Name: SPANXB1. Sample Type: A549 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for SPANXB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPANXB1

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-tail orientation with SPANX family member B2, which appears to be a duplication of the B1 locus. The SPANXB genes are unique members of this gene family, since they contain an additional 18 nt in their coding region compared to the majority of family members. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq]

Alternate Names

B1, C, Cancer/testis antigen 11.2, cancer/testis antigen family 11, member 2, CT11.1, CT11.2, CT11.2B1, CT11.3, CT11.4, CTp11, dJ171K16.1, NAP-X, Nuclear-associated protein SPAN-Xb, Nuclear-associated protein SPAN-Xf, SPANX, SPANX family member B/F, SPANX family, member B1, SPANXA, SPAN-Xa, SPANX-A, SPANXB, SPAN-Xb, SPANX-B, SPANXB2, SPANX-C, SPANX-D, SPANXE SPANX family, member E, SPAN-Xf, SPANX-F, SPANXF1, sperm protein associated with the nucleus on the X chromosome B/F, sperm protein associated with the nucleus, X chromosome, family member B1

Gene Symbol

SPANXB1

Additional SPANXB1 Products

Product Documents for SPANXB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPANXB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPANXB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPANXB1 Antibody - BSA Free and earn rewards!

Have you used SPANXB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...