SREBP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-76535

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: WESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSM

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86)% and Rat (84)%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SREBP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SREBP1 Antibody [NBP2-76535]

Immunocytochemistry/ Immunofluorescence: SREBP1 Antibody [NBP2-76535]

Immunocytochemistry/Immunofluorescence: SREBP1 Antibody [NBP2-76535] - Staining of human cell line A549 shows localization to cytosol. Antibody staining is shown in green.
SREBP1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: SREBP1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: SREBP1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-SREBP1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for SREBP1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SREBP1

SREBP (Sterol Regulatory Element Binding Protein) 1 and 2 are transcription factors which participate in the control of cholesterol homeostasis. SREBP proteins, which are attached to the endoplasmic reticulum and nuclear envelope, are proteolytically cleaved and thus activated in response to conditions of low cellular sterol. SREBPs may also play some role in the apoptotic processes.

SREBP1 is a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Long Name

Sterol regulatory element-binding protein 1

Alternate Names

bHLHd1, SREBF1, SREBP-1

Gene Symbol

SREBF1

Additional SREBP1 Products

Product Documents for SREBP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SREBP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SREBP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SREBP1 Antibody - BSA Free and earn rewards!

Have you used SREBP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...