SRRM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85821

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of SRRM1. Peptide sequence: PSPVQSQSPSTNWSPAAPAKKAKSPTPSPSPARNSDQEGGGKKKKKKKDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SRRM1 Antibody - BSA Free

Western Blot: SRRM1 Antibody [NBP2-85821]

Western Blot: SRRM1 Antibody [NBP2-85821]

Western Blot: SRRM1 Antibody [NBP2-85821] - WB Suggested Anti-Srrm1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Brain
Immunohistochemistry-Paraffin: SRRM1 Antibody [NBP2-85821]

Immunohistochemistry-Paraffin: SRRM1 Antibody [NBP2-85821]

Immunohistochemistry-Paraffin: SRRM1 Antibody [NBP2-85821] - Rabbit Anti-Srrm1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Applications for SRRM1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SRRM1

Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar preference for either double- or single-stranded nucleic acid substrates

Alternate Names

MGC39488, POP101, Ser/Arg-related nuclear matrix protein, serine/arginine repetitive matrix 1, serine/arginine repetitive matrix protein 1, SRm160, SRM160160-KD, SR-related nuclear matrix protein of 160 kDa

Gene Symbol

SRRM1

Additional SRRM1 Products

Product Documents for SRRM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SRRM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SRRM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SRRM1 Antibody - BSA Free and earn rewards!

Have you used SRRM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...