ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62540

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1. Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images

Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody [NBP1-62540]

Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody [NBP1-62540]

Western Blot: SIAT4A Antibody [NBP1-62540] - Titration: 0.2-1 ug/ml Positive Control: Human Placenta.

Applications

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A

ST3GAL1 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. It is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of ST3GAL1 protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. Correct glycosylation of the encoded protein may be critical to its sialyltransferase activity. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4B. Two transcript variants encoding the same protein have been found for this gene. Other transcript variants may exist, but have not been fully characterized yet.

Long Name

ST3 beta-Galactoside alpha-2,3-Sialyltransferase 1

Alternate Names

Alpha 2,3-ST 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1, DKFZp666E036, DKFZp779K2051, EC 2.4.99, EC 2.4.99.4, Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, Sialyltransferase 4A, sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialyltransferase), sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase), SIAT4, SIAT4A, SIAT4-A, SIATFL, SIATFLFLJ36548, ST3 beta-galactoside alpha-2,3-sialyltransferase 1, ST3Gal I, ST3GalA, ST3GalA.1MGC9183, ST3GalI, ST3GalIA, ST3GalIA1,Beta-galactoside alpha-2,3-sialyltransferase 1, ST3O, ST3OST3GalA

Gene Symbol

ST3GAL1

UniProt

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody - BSA Free

Customer Reviews

There are currently no reviews for this product. Be the first to review ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody - BSA Free and earn rewards!

Have you used ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...