STK38 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38517

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 366-465 of human STK38 (NP_009202.1).

Sequence:
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for STK38 Antibody - BSA Free

STK38 Antibody

Western Blot: STK38 Antibody [NBP3-38517] -

Western Blot: STK38 Antibody [NBP3-38517] - Western blot analysis of various lysates, using STK38 Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
STK38 Antibody

Immunocytochemistry/ Immunofluorescence: STK38 Antibody [NBP3-38517] -

Immunocytochemistry/ Immunofluorescence: STK38 Antibody [NBP3-38517] - Immunofluorescence analysis of U2OS cells using STK38 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
STK38 Antibody

Western Blot: STK38 Antibody [NBP3-38517] -

Western Blot: STK38 Antibody [NBP3-38517] - Western blot analysis of various lysates, using STK38 Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
STK38 Antibody

Immunocytochemistry/ Immunofluorescence: STK38 Antibody [NBP3-38517] -

Immunocytochemistry/ Immunofluorescence: STK38 Antibody [NBP3-38517] - Immunofluorescence analysis of L929 cells using STK38 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for STK38 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: NDR1/STK38

STK38 belongs to the NDR family of serine/threonine protein kinases. NDR kinases require the phosphorylation of conserved Ser/Thr residues for activation. NDR family members have two unique stretches of primary sequence: an N-terminal regulatory (NTR) domain and an insert of several residues between subdomains VII and VIII of the kinase domain. The kinase domain insert functions as an auto-inhibitory sequence (AIS), while binding of the co-activator MOB (Mps-one binder) proteins to the NTR domain releases NDR kinases from inhibition of autophosphorylation. STK38 negatively regulates the activation of MEKK1/2 by direct interaction with the catalytic domain of MEKK1/2. The negative regulation of MEKK1/2 is not due to its phosphorylation by STK38.

Long Name

Nuclear Dbf2-related Kinase 1

Alternate Names

STK38

Gene Symbol

STK38

Additional NDR1/STK38 Products

Product Documents for STK38 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STK38 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STK38 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STK38 Antibody - BSA Free and earn rewards!

Have you used STK38 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...