STX17 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-93968
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western, Knockdown Validated
Cited:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ
Reactivity Notes
Rat (86%).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for STX17 Antibody - BSA Free
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968]
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968]
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human endometrium shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968]
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968]
Immunohistochemistry-Paraffin: STX17 Antibody [NBP1-93968] - Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.Simple Western: STX17 Antibody [NBP1-93968]
Simple Western: STX17 Antibody [NBP1-93968] - Simple Western lane view shows a specific band for STX17 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: STX17 Antibody [NBP1-93968]
Simple Western: STX17 Antibody [NBP1-93968] - Electropherogram image(s) of corresponding Simple Western lane view. STX17 antibody was used at 1:30 dilution on RT-4 and U-251MG sp lysates(s).Immunohistochemistry: STX17 Antibody [NBP1-93968] -
Immunohistochemical detection of STX17 in liver tissue. After fixation in neutral buffered formalin for 24 h, liver samples of wild type mice were paraffin-embedded and stained for STX17 using rabbit polyclonal anti-STX17 (Novus Biologicals, Littleton, CO, USA; NBP1-93968). Heat-mediated antigen retrieval was performed in citrate buffer (pH 6.0). An accumulation of STX17-positive dots is detectable after starvation. Scale bar = 20 μm.Applications for STX17 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Simple Western
1:30
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 40 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 40 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: STX17
Alternate Names
MGC102796, MGC126613, MGC126615, syntaxin 17, syntaxin-17
Gene Symbol
STX17
Additional STX17 Products
Product Documents for STX17 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for STX17 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for STX17 Antibody - BSA Free
Customer Reviews for STX17 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review STX17 Antibody - BSA Free and earn rewards!
Have you used STX17 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...