SUCLA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56491

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDERD

Reactivity Notes

Mouse 89%, Rat 84%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SUCLA2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SUCLA2 Antibody [NBP2-56491]

Immunocytochemistry/ Immunofluorescence: SUCLA2 Antibody [NBP2-56491]

Immunocytochemistry/Immunofluorescence: SUCLA2 Antibody [NBP2-56491] - Staining of human cell line HEK 293 shows localization to mitochondria.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491] - Staining of human kidney.
Immunohistochemistry: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry: SUCLA2 Antibody [NBP2-56491] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-SUCLA2 antibody NBP2-56491 (A) shows similar protein distribution across tissues to independent antibody NBP1-85860 (B).
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491]

Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP2-56491] - Staining of human colon.

Applications for SUCLA2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SUCLA2

Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimerizes with the SCS alpha subunit to form SCS-A, an essential component of the tricarboxylic acid cycle. SCS-A hydrolyzes ATP to convert succinate to succinyl-CoA. Defects in this gene are a cause of myopathic mitochondrial DNA depletion syndrome. A pseudogene of this gene has been found on chromosome 6. (provided by RefSeq)

Alternate Names

A-BETA, ATP-specific succinyl-CoA synthetase subunit beta, beta subunit, EC 6.2.1, EC 6.2.1.5, mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta, MTDPS5, Renal carcinoma antigen NY-REN-39, succinate-CoA ligase, ADP-forming, beta subunit, succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial

Gene Symbol

SUCLA2

Additional SUCLA2 Products

Product Documents for SUCLA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SUCLA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SUCLA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SUCLA2 Antibody - BSA Free and earn rewards!

Have you used SUCLA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...