Synaptotagmin 12 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-15537

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Synaptotagmin 12 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 95-200 of human Synaptotagmin 12 (NP_001171351.1). KGSLSIEDTFESISELGPLELMGRELDLAPYGTLRKSQSADSLNSISSVSNTFGQDFTLGQVEVSMEYDTASHTLNVAVMQGKDLLEREEASFESCFMRVSLLPDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Synaptotagmin 12 Antibody - Azide and BSA Free

Western Blot: Synaptotagmin 12 AntibodyAzide and BSA Free [NBP3-15537]

Western Blot: Synaptotagmin 12 AntibodyAzide and BSA Free [NBP3-15537]

Western Blot: Synaptotagmin 12 Antibody [NBP3-15537] - Analysis of extracts of Mouse brain, using Synaptotagmin 12 Rabbit pAb (NBP3-15537) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: Synaptotagmin 12 Antibody - Azide and BSA Free [NBP3-15537]

Immunocytochemistry/ Immunofluorescence: Synaptotagmin 12 Antibody - Azide and BSA Free [NBP3-15537]

Immunocytochemistry/Immunofluorescence: Synaptotagmin 12 Antibody [NBP3-15537] - Immunofluorescence analysis of L929 cells using Synaptotagmin 12 antibody (NBP3-15537) at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for Synaptotagmin 12 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Synaptotagmin 12

May be involved in ca(2+)-dependent exocytosis of secretory vesicles through ca(2+) and phospholipid binding to the c2 domain or may serve as ca(2+) sensors in the process of vesicular trafficking and exocytosis.

Alternate Names

SRG1, synaptotagmin XIIsynaptotagmin-XII, synaptotagmin-12, SYT11, sytXII

Gene Symbol

SYT12

Additional Synaptotagmin 12 Products

Product Documents for Synaptotagmin 12 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synaptotagmin 12 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Synaptotagmin 12 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Synaptotagmin 12 Antibody - Azide and BSA Free and earn rewards!

Have you used Synaptotagmin 12 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies