Syndecan-2/CD362 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-25169

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody has been engineered to specifically recognize the recombinant protein Syndecan-2/CD362 using the following amino acid sequence: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Syndecan-2/CD362 Antibody - BSA Free

Syndecan-2/CD362 Antibody Immunocytochemistry/Immunofluorescence: Syndecan-2/CD362 Antibody [NBP3-25169]

Immunocytochemistry/Immunofluorescence: Syndecan-2/CD362 Antibody [NBP3-25169]

Staining of human cell line U2OS shows localization to plasma membrane.

Applications for Syndecan-2/CD362 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 µg/ml
Application Notes
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Syndecan-2/CD362

Proteoglycans are macromolecules consisting of a variety of core proteins with covalently attached one or several polysaccharide chains of the glycosaminoglycan type (heparan sulphate, heparin, chondroitin sulphate, dermatan sulphate or keratan sulphate). At least two forms of basement membrane heparan sulphate proteoglycan (HSPG) have been identified. One with a large core protein (> 400 kD) and one with a small core protein (30 kD). The large HSPG is probably the most abundant basement membrane proteoglycan. It is located predominantly in the lamina lucida, where it forms clustered aggregates and interacts with other basement membrane components to form the matrix. In addition, it also plays a critical role in attachment of cells to the basal membrane via integrin receptors.

Alternate Names

CD362, Fibroglycan, HSPG1, SDC2, SYND2, Syndecan2

Gene Symbol

SDC2

Additional Syndecan-2/CD362 Products

Product Documents for Syndecan-2/CD362 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Syndecan-2/CD362 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Syndecan-2/CD362 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Syndecan-2/CD362 Antibody - BSA Free and earn rewards!

Have you used Syndecan-2/CD362 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies