Syntaxin-BP1 Antibody (1N7U1)

Novus Biologicals | Catalog # NBP3-33541

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1N7U1
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Syntaxin-BP1 (P61764).

Sequence:
STYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Syntaxin-BP1 Antibody (1N7U1)

Syntaxin-BP1 Antibody (1N7U1)

Western Blot: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] -

Western Blot: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Western blot analysis of lysates from HeLa cells, using Syntaxin-BP1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
Syntaxin-BP1 Antibody (1N7U1)

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] -

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded human pancreas tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Syntaxin-BP1 Antibody (1N7U1)

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] -

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded rat pancreas tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Syntaxin-BP1 Antibody (1N7U1)

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] -

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded human brain tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Syntaxin-BP1 Antibody (1N7U1)

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] -

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded mouse pancreas tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Syntaxin-BP1 Antibody (1N7U1)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Syntaxin-BP1

Munc-18 (mammalian homologue of Unc-18) is a protein that is thought to be involved in regulating exocytosis due, at least in part to its ability to bind syntaxin (Ciufo et al., 2005). Munc18-1 is a neuron-specific member of the Sec1/Munc18 protein family that binds to syntaxin1A and is thought to stabilize the complex (Liu et al., 2004). The function of Munc-18 is thought to be regulated by PKC phosphorylation of Ser515 on the Munc-18 protein (Sassa et al., 1996).

Long Name

Syntaxin-binding Protein 1

Alternate Names

EIEE4, p67, rbSec1, STXBP1, SyntaxinBP1, UNC18

Gene Symbol

STXBP1

Additional Syntaxin-BP1 Products

Product Documents for Syntaxin-BP1 Antibody (1N7U1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Syntaxin-BP1 Antibody (1N7U1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Syntaxin-BP1 Antibody (1N7U1)

There are currently no reviews for this product. Be the first to review Syntaxin-BP1 Antibody (1N7U1) and earn rewards!

Have you used Syntaxin-BP1 Antibody (1N7U1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...