TADA3L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94077

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TADA3L Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human TADA3 (NP_597814.1). EENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TADA3L Antibody - BSA Free

Western Blot: TADA3L AntibodyAzide and BSA Free [NBP2-94077]

Western Blot: TADA3L AntibodyAzide and BSA Free [NBP2-94077]

Western Blot: TADA3L Antibody [NBP2-94077] - Analysis of extracts of various cell lines, using TADA3L at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: TADA3L Antibody - Azide and BSA Free [NBP2-94077]

Immunocytochemistry/ Immunofluorescence: TADA3L Antibody - Azide and BSA Free [NBP2-94077]

Immunocytochemistry/Immunofluorescence: TADA3L Antibody [NBP2-94077] - Analysis of C6 cells using TADA3L at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for TADA3L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TADA3L

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated genetranscription by interacting functionally with the general transcription machinery bound at the basal promoter.Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, therebyrelieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activatoradaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumorsuppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least fouralternatively spliced variants have been found for this gene, but the full-length nature of some variants has not beendetermined. (provided by RefSeq)

Alternate Names

ADA3, ADA3 homolog, alteration/deficiency in activation 3, epididymis secretory sperm binding protein, FLJ20221, FLJ21329, hADA3, NGG1, STAF54, TADA3L, transcriptional adapter 3, Transcriptional adapter 3-like, transcriptional adaptor 3

Gene Symbol

TADA3

Additional TADA3L Products

Product Documents for TADA3L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TADA3L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for TADA3L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TADA3L Antibody - BSA Free and earn rewards!

Have you used TADA3L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies