TAF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10485

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TAF6 (NP_005632). Peptide sequence PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TAF6 Antibody - BSA Free

Western Blot: TAF6 Antibody [NBP3-10485]

Western Blot: TAF6 Antibody [NBP3-10485]

Western Blot: TAF6 Antibody [NBP3-10485] - Western blot analysis using NBP3-10485 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for TAF6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAF6

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds weakly to TBP but strongly to TAF1, the largest subunit of TFIID. Four isoforms have been identified but complete transcripts have been determined for only three isoforms. One of the isoforms has been shown to preclude binding of one of the other TFIID subunits, thereby reducing transcription and initiating signals that trigger apoptosis.

Alternate Names

DKFZp781E21155, MGC:8964, RNA polymerase II, E, 70/85kD, TAF(II)70, TAF(II)80, TAF2ERNA polymerase II TBP-associated factor subunit E, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, TAFII70TAFII-80, TAFII80TAFII-70, TAFII85, Transcription initiation factor TFIID 70 kDa subunit, Transcription initiation factor TFIID 80 kDa subunit, transcription initiation factor TFIID subunit 6

Gene Symbol

TAF6

Additional TAF6 Products

Product Documents for TAF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TAF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TAF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAF6 Antibody - BSA Free and earn rewards!

Have you used TAF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...