TARS Antibody (1A9) - Azide and BSA Free
Novus Biologicals | Catalog # H00006897-M01
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 1A9
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
TARS (NP_689508, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAELNPWPEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLK
Specificity
TARS - threonyl-tRNA synthetase
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for TARS Antibody (1A9) - Azide and BSA Free
Immunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01]
TARS-Antibody-1A9-Immunohistochemistry-Paraffin-H00006897-M01-img0006.jpgImmunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01]
TARS-Antibody-1A9-Immunohistochemistry-Paraffin-H00006897-M01-img0007.jpgWestern Blot: TARS Antibody (1A9) [H00006897-M01]
Western Blot: TARS Antibody (1A9) [H00006897-M01] - TARS monoclonal antibody (M01), clone 1A9 Analysis of TARS expression in HeLa.Immunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01]
Immunohistochemistry-Paraffin: TARS Antibody (1A9) [H00006897-M01] - Analysis of monoclonal antibody to TARS on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.Immunohistochemistry: TARS Antibody (1A9) [H00006897-M01] -
Immunohistochemistry: TARS Antibody (1A9) [H00006897-M01] - TARS expression co-localized with VEGF & in leukocytes. Tissues were stained by IHC as in Figure 2. Shown are 40x images of serial sections stained with (A,B) No primary Ab as a negative control (C,D) TARS or (E,F) VEGF. Bottom panels show examples of TARS staining in infiltrating leukocytes. Bar = 50 μm. See Additional File 3 for supporting images. Image collected & cropped by CiteAb from the following publication (https://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-620), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: TARS Antibody (1A9) [H00006897-M01] -
Immunohistochemistry: TARS Antibody (1A9) [H00006897-M01] - TARS expression increases with stage of ovarian cancer. A. Tissues were stained for TARS by immunohistochemistry & counter-stained with Mayers’ hematoxylin. Images were scored blindly by 2 independent investigators & tumor identification was later confirmed by a pathologist (SLM). Shown are 10x images from (1) normal ovary & examples of TARS score increasing with extent of disease (2–4), Bar = 100 μm. B. Graph representing average scores where high stage is ≥ stage 3; statistical significance determined by one-way ANOVA. For more detailed statistics, see Table 1 for Pearson’s Correlations. C. Shown is a graph of individual patient TARS tumor scores grouped according to FIGO stage of disease (i.e. Stage 3.75 = FIGO 3C). Image collected & cropped by CiteAb from the following publication (https://bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-620), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TARS Antibody (1A9) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and IHC-P.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: TARS
Alternate Names
cytoplasmic, EC 6.1.1.3, MGC9344, Threonine--tRNA ligase, threonyl-tRNA synthetase, threonyl-tRNA synthetase, cytoplasmic
Entrez Gene IDs
6897 (Human)
Gene Symbol
TARS1
OMIM
187790 (Human)
UniProt
Additional TARS Products
Product Documents for TARS Antibody (1A9) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TARS Antibody (1A9) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TARS Antibody (1A9) - Azide and BSA Free
Customer Reviews for TARS Antibody (1A9) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review TARS Antibody (1A9) - Azide and BSA Free and earn rewards!
Have you used TARS Antibody (1A9) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...