TBK1 Recombinant Protein Antigen
Novus Biologicals | Catalog # NBP2-55777PEP
Key Product Details
Source
Tag
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: TATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVV
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation, and Storage
NBP2-55777PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: TBK1
Long Name
Alternate Names
Gene Symbol
Additional TBK1 Products
Product Documents for TBK1 Recombinant Protein Antigen
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TBK1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for TBK1 Recombinant Protein Antigen
There are currently no reviews for this product. Be the first to review TBK1 Recombinant Protein Antigen and earn rewards!
Have you used TBK1 Recombinant Protein Antigen?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
FAQs for TBK1 Recombinant Protein Antigen
-
Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?
A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Q: Cant this TBK1 antibody be conjugated to PE for FLOW?
A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.
-
Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
Q: Is there a smaller size of your TBK1 antibody?
A: This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Q: What is the exact sequence this TBK1 antibody recognizes?
A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
-
Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?
A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Q: Cant this TBK1 antibody be conjugated to PE for FLOW?
A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.
-
Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
Q: Is there a smaller size of your TBK1 antibody?
A: This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Q: What is the exact sequence this TBK1 antibody recognizes?
A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
-
Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?
A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Q: Cant this TBK1 antibody be conjugated to PE for FLOW?
A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.
-
Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
Q: Is there a smaller size of your TBK1 antibody?
A: This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Q: What is the exact sequence this TBK1 antibody recognizes?
A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
-
Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?
A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Q: Cant this TBK1 antibody be conjugated to PE for FLOW?
A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.
-
Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
Q: Is there a smaller size of your TBK1 antibody?
A: This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Q: What is the exact sequence this TBK1 antibody recognizes?
A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
-
Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?
A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Q: Cant this TBK1 antibody be conjugated to PE for FLOW?
A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.
-
Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
Q: Is there a smaller size of your TBK1 antibody?
A: This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Q: What is the exact sequence this TBK1 antibody recognizes?
A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
-
Q: Are there any publications where this TBK1 antibody was used in western blot for mouse?
A: This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Q: Cant this TBK1 antibody be conjugated to PE for FLOW?
A: Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.
-
Q: I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
A: While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
Q: Is there a smaller size of your TBK1 antibody?
A: This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Q: We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
A: Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Q: What is the exact sequence this TBK1 antibody recognizes?
A: The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.