TDO2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00006999-B01P

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TDO2 (NP_005642.1, 1 a.a. - 406 a.a.) full-length human protein. MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27190010). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

TDO2 - tryptophan 2,3-dioxygenase,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for TDO2 Antibody - Azide and BSA Free

Knockout Validated: TDO2 Antibody [H00006999-B01P]

Western Blot: TDO2 Antibody [H00006999-B01P]

TDO2-Antibody-Western-Blot-H00006999-B01P-img0006.jpg
Western Blot: TDO2 Antibody [H00006999-B01P]

Western Blot: TDO2 Antibody [H00006999-B01P]

Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

TDO2-Antibody-Immunocytochemistry-Immunofluorescence-H00006999-B01P-img0009.jpg
Western Blot: TDO2 Antibody [H00006999-B01P]

Western Blot: TDO2 Antibody [H00006999-B01P]

Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in human liver.
Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

TDO2-Antibody-Immunocytochemistry-Immunofluorescence-H00006999-B01P-img0007.jpg
Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

TDO2-Antibody-Immunocytochemistry-Immunofluorescence-H00006999-B01P-img0008.jpg
Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

Immunohistochemistry: TDO2 Antibody [H00006999-B01P]

TDO2-Antibody-Immunohistochemistry-H00006999-B01P-img0010.jpg
TDO2 Antibody

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] -

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TDO2 Antibody

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] -

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TDO2 Antibody

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] -

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TDO2 Antibody

Western Blot: TDO2 Antibody [H00006999-B01P] -

Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TDO2 Antibody

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] -

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TDO2 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TDO2

Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM]

Long Name

Tryptophan 2,3-dioxygenase

Alternate Names

chky, TDO, TO, TRPO, Tryptophan Oxygenase, Tryptophan Pyrrolase, Tryptophanase

Entrez Gene IDs

6999 (Human)

Gene Symbol

TDO2

Additional TDO2 Products

Product Documents for TDO2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TDO2 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TDO2 Antibody - Azide and BSA Free

Customer Reviews for TDO2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TDO2 Antibody - Azide and BSA Free and earn rewards!

Have you used TDO2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TDO2 Antibody - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Why do you guys see two different molecular weight bands, one around 46 kDa in HEK cell lysates and the other around 50 kDa in liver lysates?

    A: From the data I have available, the reason you see the molecular weight running slightly lower in the HEK lysate is because these cells were transfected with a partial length protein (a few aa short of the full length). The liver lysate will show you the correct sizing of the endogenous expression. The theoretical molecular weight of this protein is ~48kDa. However the observed weight can vary slightly due to your experimental conditions.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...