TEM8/ANTXR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62488

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ANTXR1(anthrax toxin receptor 1) The peptide sequence was selected form the middle region of ANTXR1. Peptide sequence VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for TEM8/ANTXR1 Antibody - BSA Free

Western Blot: TEM8/ANTXR1 Antibody [NBP1-62488]

Western Blot: TEM8/ANTXR1 Antibody [NBP1-62488]

Western Blot: TEM8 Antibody [NBP1-62488] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for TEM8/ANTXR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TEM8/ANTXR1

ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes.The protein encoded by this gene is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. This protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants have been described.

Long Name

Tumor Endothelial Marker 8/Anthrax Toxin Receptor 1

Alternate Names

ANTXR1

Gene Symbol

ANTXR1

OMIM

NP_115584 (Human)

UniProt

Additional TEM8/ANTXR1 Products

Product Documents for TEM8/ANTXR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TEM8/ANTXR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TEM8/ANTXR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TEM8/ANTXR1 Antibody - BSA Free and earn rewards!

Have you used TEM8/ANTXR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...