TFEC Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10931

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TFEC (NP_001018068). Peptide sequence MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TFEC Antibody - BSA Free

Western Blot: TFEC Antibody [NBP3-10931]

Western Blot: TFEC Antibody [NBP3-10931]

Western Blot: TFEC Antibody [NBP3-10931] - Western blot analysis of TFEC in Jurkat cell lysate as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for TFEC Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TFEC

Transcriptional regulator that acts as a repressor or an activator. Acts as a transcriptional repressor on minimal promoter containing element F (that includes an E-box sequence). Binds to element F in an E-box sequence-specific manner. Acts as a transcriptional transactivator on the proximal promoter region of the tartrate-resistant acid phosphatase (TRAP) E-box containing promoter. Collaborates with MITF in target gene activation. Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence. Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer. Binds DNA in a homo- or heterodimeric form

Alternate Names

Class E basic helix-loop-helix protein 34, hTFEC-L, TCFECTFECLbHLHe34BHLHE34, TFE-C, transcription factor EC, Transcription factor EC-like

Gene Symbol

TFEC

Additional TFEC Products

Product Documents for TFEC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TFEC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFEC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFEC Antibody - BSA Free and earn rewards!

Have you used TFEC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...