Thromboxane A2 R/TBXA2R Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10561

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Thromboxane A2 R/TBXA2R (NP_001051.1). Peptide sequence EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Thromboxane A2 R/TBXA2R Antibody - BSA Free

Western Blot: Thromboxane A2 R/TBXA2R Antibody [NBP3-10561]

Western Blot: Thromboxane A2 R/TBXA2R Antibody [NBP3-10561]

Western Blot: Thromboxane A2 R/TBXA2R Antibody [NBP3-10561] - Western blot analysis of Thromboxane A2 R/TBXA2R in U937 Whole cell lysates. Antibody dilution at 1.0ug/ml

Applications for Thromboxane A2 R/TBXA2R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Thromboxane A2 R/TBXA2R

The thromboxane A2 receptor (TBXA2R) is a member of the Prostanoid Receptor subfamily. TBXA2R performs an essential role in hemostasis by interacting with thromboxane A2 to induce platelet aggregation. Thromboxane A2 has been implicated in myocardial infarct, stroke, and asthma. Additionally, thromboxane-prostanoid receptors have been implicated in the pathogenesis of cardiovascular diseases. Changes in TBXA2R function have also been linked to a hereditary bleeding disorder. The thromboxane A2 receptor is encoded by a single gene that is alternatively spliced at the carboxyl terminus, resulting in two variants, TP (343 residues) and TP (407 residues) that share the first 328 amino acids.

Long Name

Thromboxane A2 Receptor

Alternate Names

BDPLT13, Prostanoid TP Receptor, TBXA2R, Thromboxane A2R, TP, TXA2R2

Gene Symbol

TBXA2R

Additional Thromboxane A2 R/TBXA2R Products

Product Documents for Thromboxane A2 R/TBXA2R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Thromboxane A2 R/TBXA2R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Thromboxane A2 R/TBXA2R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Thromboxane A2 R/TBXA2R Antibody - BSA Free and earn rewards!

Have you used Thromboxane A2 R/TBXA2R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...