Tight Junction Protein 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91621

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Rat

Cited:

Rat

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards ZO-1 tight junction protein. Peptide sequence AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE. The peptide sequence for this immunogen was taken from within the described region.

Marker

Intercellular Junctions/Tight Junction Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

190 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Tight Junction Protein 1 Antibody - BSA Free

Western Blot: Tight Junction Protein 1 Antibody [NBP1-91621]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-91621]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-91621] - Tight Junction Protein 1 Antibody Rat Lung Lysate 1ug/ml Gel Concentration 6-18%

Applications for Tight Junction Protein 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tight Junction Protein 1

Members of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-1, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-1 is a peripheral membrane protein bound on the cytoplasmic surface of junctional contacts and is expressed in all tight junctions regardless of their properties. ZO-1 immunoprecipitates with its family member ZO-2. ZO-1 was shown to undergo tyrosine phosphorylation during tight junction formation and remodeling. Two different isoforms of ZO-1, alpha-minus and alpha-plus, have been described, which result from alternative splicing of an mRNA encoded by a single gene. The ZO-1 alpha-plus contains an 80 amino acids motif called alpha which is not present in ZO-1 alpha-minus. The alpha-containing isoform is found in most epithelial cell junctions. The short isoform (ZO-1 alpha-minus) is found both in endothelial cells and the highly specialized epithelial junctions of renal glomeruli and Sertoli cells of the seminiferous tubules. This difference in distribution provides molecular distinction among tight junctions.

Alternate Names

DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1

Gene Symbol

TJP1

Additional Tight Junction Protein 1 Products

Product Documents for Tight Junction Protein 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Tight Junction Protein 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Tight Junction Protein 1 Antibody - BSA Free

Customer Reviews for Tight Junction Protein 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tight Junction Protein 1 Antibody - BSA Free and earn rewards!

Have you used Tight Junction Protein 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...