TMEFF2/Tomoregulin-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09231

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2/Tomoregulin-2. Peptide sequence NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TMEFF2/Tomoregulin-2 Antibody - BSA Free

Western Blot: TMEFF2/Tomoregulin-2 Antibody [NBP3-09231]

Western Blot: TMEFF2/Tomoregulin-2 Antibody [NBP3-09231]

Western Blot: TMEFF2/Tomoregulin-2 Antibody [NBP3-09231] - Western blot analysis of TMEFF2/Tomoregulin-2 in Colorectal Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for TMEFF2/Tomoregulin-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEFF2/Tomoregulin-2

TMEFF2(transmembrane protein with EGF-like and two follistatin-like domains 2), a gene encoding a plasma membrane protein with two follistatin-like domains and one epidermal growth factor-like domain, had limited normal tissue distribution and was highly overexpressed in prostate cancer. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. Down-regulated in tumor cell lines in response to a high level of methylation in the 5' region. Clone J4B6, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human TMEFF2 protein.

Long Name

Transmembrane Protein with EFG-like and two Follistatin-like Domains

Alternate Names

TENB2, Tomoregulin-2, Tomoregulin2

Gene Symbol

TMEFF2

Additional TMEFF2/Tomoregulin-2 Products

Product Documents for TMEFF2/Tomoregulin-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TMEFF2/Tomoregulin-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for TMEFF2/Tomoregulin-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TMEFF2/Tomoregulin-2 Antibody - BSA Free and earn rewards!

Have you used TMEFF2/Tomoregulin-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...