TOMM20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81556

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Rat

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TOMM20 Antibody - BSA Free

Western Blot: TOMM20 Antibody [NBP1-81556]

Western Blot: TOMM20 Antibody [NBP1-81556]

Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in human cell lines HEK293 and MCF-7. Corresponding TOMM20 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western Blot: TOMM20 Antibody [NBP1-81556]

Western Blot: TOMM20 Antibody [NBP1-81556]

Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in mouse cell line NIH-3T3.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human endometrium shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human prostate shows moderate to strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556]

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human cerebral cortex shows moderate to strong positivity in mitochondria in neurons.
Simple Western: TOMM20 Antibody [NBP1-81556]

Simple Western: TOMM20 Antibody [NBP1-81556]

Simple Western: TOMM20 Antibody [NBP1-81556] - Simple Western lane view shows a specific band for TOMM20 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: TOMM20 Antibody [NBP1-81556]

Simple Western: TOMM20 Antibody [NBP1-81556]

Simple Western: TOMM20 Antibody [NBP1-81556] - Electropherogram image(s) of corresponding Simple Western lane view. TOMM20 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).
TOMM20 Antibody

Western Blot: TOMM20 Antibody [NBP1-81556] -

Western Blot: TOMM20 Antibody [NBP1-81556] - Quantification of LC3B-II & TOM20 proteins in WT & Ts1Cje hippocampus. Hippocampal proteins from WT & Ts1Cje mice pairs were analyzed in Western blot with anti-LC3B or anti-TOM20 antibody. A LC3B western blot showing WT & Ts1Cje littermate pairs analyzed & total protein loaded. The ratio LC3B-II/LC3B-I is shown as the mean ± SEM (WT: 0.8714 ± 0.04154; Ts1Cje: 0.6500 ± 0.06802; p = 0.0152, Student’s t-test, n = 7 for WT & n = 6 for Ts1Cje). B TOM20 western blot showing WT & Ts1Cje littermate pairs analyzed & total protein loaded. The signals were normalized to the corresponding total protein loaded & the mean ± SEM values are shown (WT: 1.024 ± 0.08799; Ts1Cje: 1.412 ± 0.1452; p = 0.0414, Student’s t-test, n = 7 animals per genotype) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/34034796), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TOMM20 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody [NBP1-81556]

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody [NBP1-81556]

Staining of human cell line U-2 OS shows localization to mitochondria.

Applications for TOMM20 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Simple Western

1:30

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 18 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reviewed Applications

Read 3 reviews rated 4.3 using NBP1-81556 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOMM20

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Long Name

TOMM20

Alternate Names

MAS20, mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolo, MOM19, outer mitochondrial membrane receptor Tom20, TOM20, translocase of outer mitochondrial membrane 20 hom

Gene Symbol

TOMM20

Additional TOMM20 Products

Product Documents for TOMM20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TOMM20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TOMM20 Antibody - BSA Free

Customer Reviews for TOMM20 Antibody - BSA Free (3)

4.3 out of 5
3 Customer Ratings
5 Stars
33%
4 Stars
67%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used TOMM20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 3 of 3 reviews Showing All
Filter By:
  • TOMM20 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Human primary fibroblast
    Species: Human
    Verified Customer | Posted 10/31/2020
    Tomm20 antibody in human primary fibroblasts. 1:200 dilution. Secondary ab: Donkey anti-rabbit Alexa Fluor 488. Nuclear staining with DAPI.
    PFA 4% 15 min fixed. Ab incubation:1:200 dilution O/N 4ºC in 10% Donkey Serum in PBST (0.1% Triton). Secondary antibody Donkey anti-rabbit Alexa Fluor 488 1:500 2h RT in 10% Donkey Serum in PBST (0.1% Triton).
    TOMM20 Antibody - BSA Free NBP1-81556
  • TOMM20 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: 293FT cell lysate and nih3t3 cell lysate
    Species: Human and Mouse
    Verified Customer | Posted 06/29/2017
    TOMM20 Antibody - BSA Free NBP1-81556
  • TOMM20 Antibody
    Name: Steve Gillmore
    Application: Immunocytochemistry
    Sample Tested: Retinal Pigmented Epithelial Cells
    Species: Human
    Verified Customer | Posted 04/10/2017
    RPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing 2.5% BSA overnight at 4 deg C. Cells were incubated with anti-rabbit secondary antibody and counterstained with hoescht 33342. Image was collected using Zeiss 780 LSM.
    TOMM20 Antibody - BSA Free NBP1-81556

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...