TOP2B Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89527
![TOP2B Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: TOP2B Antibody - BSA Free [NBP1-89527]](https://resources.rndsystems.com/images/products/nbp1-89527_rabbit-polyclonal-top2b-antibody-15520258244613.jpg "Immunocytochemistry/ Immunofluorescence: TOP2B Antibody - BSA Free [NBP1-89527]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Rat, Insect - Drosophila
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSA
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TOP2B Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: TOP2B Antibody - BSA Free [NBP1-89527]
Staining of human cell line U-251 MG shows localization to nucleoplasm.![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]](https://resources.rndsystems.com/images/products/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0020.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]")
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human pancreas shows weak to moderate nuclear positivity in islets of Langerhans and exocrine glandular cells.![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]](https://resources.rndsystems.com/images/products/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0017.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]")
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]](https://resources.rndsystems.com/images/products/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0018.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]")
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human gastrointestinal shows strong nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]](https://resources.rndsystems.com/images/products/TOP2B-Antibody-Immunohistochemistry-Paraffin-NBP1-89527-img0019.jpg "Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]")
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527]
Immunohistochemistry-Paraffin: TOP2B Antibody [NBP1-89527] - Staining of human kidney shows moderate nuclear positivity in cells in glomeruli and tubules.![Simple Western: TOP2B Antibody [NBP1-89527]](https://resources.rndsystems.com/images/products/TOP2B-Antibody-Simple-Western-NBP1-89527-img0007.jpg "Simple Western: TOP2B Antibody [NBP1-89527]")
Simple Western: TOP2B Antibody [NBP1-89527]
Simple Western: TOP2B Antibody [NBP1-89527] - Simple Western lane view shows a specific band for TOP2B in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.![Simple Western: TOP2B Antibody [NBP1-89527]](https://resources.rndsystems.com/images/products/TOP2B-Antibody-Simple-Western-NBP1-89527-img0008.jpg "Simple Western: TOP2B Antibody [NBP1-89527]")
Simple Western: TOP2B Antibody [NBP1-89527]
Simple Western: TOP2B Antibody [NBP1-89527] - Electropherogram image(s) of corresponding Simple Western lane view. TOP2B antibody was used at 1:100 dilution on RT-4 lysate(s).![TOP2B Antibody - BSA Free Western Blot: TOP2B Antibody - BSA Free [NBP1-89527]](https://resources.rndsystems.com/images/products/nbp1-89527_rabbit-polyclonal-top2b-antibody-15520258225016.jpg "Western Blot: TOP2B Antibody - BSA Free [NBP1-89527]")
![TOP2B Antibody - BSA Free Western Blot: TOP2B Antibody - BSA Free [NBP1-89527]](https://resources.rndsystems.com/images/products/nbp1-89527_rabbit-polyclonal-top2b-antibody-15520258303342.jpg "Western Blot: TOP2B Antibody - BSA Free [NBP1-89527]")
Western Blot: TOP2B Antibody - BSA Free [NBP1-89527]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Applications for TOP2B Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Simple Western
1:100
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:100, apparent MW was 199 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:100, apparent MW was 199 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Reviewed Applications
Read 2 reviews rated 4 using NBP1-89527 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TOP2B
Long Name
DNA Topoisomerase II beta
Alternate Names
antigen MLAA-44, DNA topoisomerase 2-beta, DNA topoisomerase II beta, DNA topoisomerase II, 180 kD, DNA topoisomerase II, beta isozyme, EC 5.99.1.3, top2beta, TOPIIB, topo II beta, topoisomerase (DNA) II beta (180kD), topoisomerase (DNA) II beta 180kDa, topoisomerase II beta, topoisomerase IIb, U937 associated antigen
Gene Symbol
TOP2B
Additional TOP2B Products
Product Documents for TOP2B Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TOP2B Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TOP2B Antibody - BSA Free
Powered by Bioz
Customer Reviews for TOP2B Antibody - BSA Free (2)
4 out of 5
2 Customer Ratings
Have you used TOP2B Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: fibroblastsSpecies: HumanVerified Customer | Posted 08/04/2016TOP2B
-
Application: ImmunofluorescenceSample Tested: fibroblastsSpecies: HumanVerified Customer | Posted 06/29/2016TOP2B in Fibroblasts
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...