TP53I11 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93452

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TP53I11 (NP_001245249.1). MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TP53I11 Antibody - Azide and BSA Free

Western Blot: TP53I11 AntibodyAzide and BSA Free [NBP2-93452]

Western Blot: TP53I11 AntibodyAzide and BSA Free [NBP2-93452]

Western Blot: TP53I11 Antibody [NBP2-93452] - Western blot analysis of extracts of various cell lines, using TP53I11 antibody (NBP2-93452) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: TP53I11 Antibody - Azide and BSA Free [NBP2-93452]

Immunohistochemistry-Paraffin: TP53I11 Antibody - Azide and BSA Free [NBP2-93452]

Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-93452] - Paraffin-embedded rat spleen using TP53I11.
Immunohistochemistry-Paraffin: TP53I11 Antibody - Azide and BSA Free [NBP2-93452]

Immunohistochemistry-Paraffin: TP53I11 Antibody - Azide and BSA Free [NBP2-93452]

Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-93452] - Paraffin-embedded Human lymph node tumors using TP53I11.
Immunohistochemistry-Paraffin: TP53I11 Antibody - Azide and BSA Free [NBP2-93452]

Immunohistochemistry-Paraffin: TP53I11 Antibody - Azide and BSA Free [NBP2-93452]

Immunohistochemistry-Paraffin: TP53I11 Antibody [NBP2-93452] - Paraffin-embedded mouse heart using TP53I11.

Applications for TP53I11 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TP53I11

Alternate Names

p53-induced protein, PIG11p53-induced gene 11 protein, tumor protein p53 inducible protein 11, tumor protein p53-inducible protein 11

Gene Symbol

TP53I11

Additional TP53I11 Products

Product Documents for TP53I11 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TP53I11 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for TP53I11 Antibody - Azide and BSA Free

Customer Reviews for TP53I11 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TP53I11 Antibody - Azide and BSA Free and earn rewards!

Have you used TP53I11 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...