TPD52 Antibody (1B6) - Azide and BSA Free
Novus Biologicals | Catalog # H00007163-M01
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Sandwich ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 1B6
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Specificity
TPD52 - tumor protein D52 (1B6)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for TPD52 Antibody (1B6) - Azide and BSA Free
Western Blot: TPD52 Antibody (1B6) [H00007163-M01]
Western Blot: TPD52 Antibody (1B6) [H00007163-M01] - Analysis of TPD52 expression in transfected 293T cell line by TPD52 monoclonal antibody (M01), clone 1B6.Lane 1: TPD52 transfected lysate(19.863 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: TPD52 Antibody (1B6) [H00007163-M01] - Detection limit for recombinant GST tagged TPD52 is approximately 1ng/ml as a capture antibody.
Applications for TPD52 Antibody (1B6) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: TPD52
Alternate Names
D52, hD52, N8L, PC-1, PrLZ, prostate and colon associated protein, prostate leucine zipper, Protein N8, tumor protein D52
Entrez Gene IDs
7163 (Human)
Gene Symbol
TPD52
UniProt
Additional TPD52 Products
Product Documents for TPD52 Antibody (1B6) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TPD52 Antibody (1B6) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for TPD52 Antibody (1B6) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review TPD52 Antibody (1B6) - Azide and BSA Free and earn rewards!
Have you used TPD52 Antibody (1B6) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...