Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

Novus Biologicals | Catalog # H00006949-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 8H3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

TCOF1 (NP_001008657, 2 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI

Localization

Nucleus, nucleolus.

Specificity

TCOF1 - Treacher Collins-Franceschetti syndrome 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

Western Blot: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02]

Western Blot: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02]

Western Blot: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02] - Analysis of TCOF1 expression in transfected 293T cell line by TCOF1 monoclonal antibody (M02), clone 8H3.Lane 1: TCOF1 transfected lysate(152.104 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02]

Immunocytochemistry/ Immunofluorescence: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02]

Immunocytochemistry/Immunofluorescence: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02] - Analysis of monoclonal antibody to TCOF1 on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02]

ELISA: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02]

ELISA: Treacher Collins syndrome protein Antibody (8H3) [H00006949-M02] - Detection limit for recombinant GST tagged TCOF1 is 0.3 ng/ml as a capture antibody.

Applications for Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Treacher Collins syndrome protein

This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only three of them have been characterized to date.

Alternate Names

MFD1, nucleolar trafficking phosphoprotein, TCS1, Treacher Collins syndrome protein, Treacher Collins-Franceschetti syndrome 1, treacle, treacle protein

Entrez Gene IDs

6949 (Human)

Gene Symbol

TCOF1

OMIM

154500 (Human)

Additional Treacher Collins syndrome protein Products

Product Documents for Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free and earn rewards!

Have you used Treacher Collins syndrome protein Antibody (8H3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...