TRIB1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-55386
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to TRIB1(tribbles homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of TRIB1 (NP_079471). Peptide sequence TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for TRIB1 Antibody - BSA Free
Western Blot: TRIB1 Antibody [NBP1-55386]
Western Blot: TRIB1 Antibody [NBP1-55386] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human IntestineImmunohistochemistry-Paraffin: TRIB1 Antibody [NBP1-55386] -
Immunohistochemistry-Paraffin: TRIB1 Antibody [NBP1-55386] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I & II cells; Primary Antibody Concentration: 1:100Western Blot: TRIB1 Antibody [NBP1-55386]
Western Blot: TRIB1 Antibody [NBP1-55386] - COLO205, Antibody Dilution: 1.0 ug/ml TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205.Western Blot: TRIB1 Antibody [NBP1-55386]
Western Blot: TRIB1 Antibody [NBP1-55386] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/mlImmunohistochemistry: TRIB1 Antibody - BSA Free [NBP1-55386] -
Trib1 expression was downregulated during the early phase of liver regeneration.A–C C57B6/L mice were subjected to partial hepatectomy (2/3 PHx) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. D–F C57B6/L mice were injected with acetaminophen (APAP, 300 mg/kg) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. G, H Primary murine hepatocytes were treated with HGF and harvested at indicated time points. Trib1 expression was examined by qPCR and western blotting. N = 3 biological replicates. Data are expressed as mean +/- S.D. *p < 0.05, one-way ANOVA with post-hoc Scheff´e. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37355685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: TRIB1 Antibody - BSA Free [NBP1-55386] -
Trib1 expression was downregulated during the early phase of liver regeneration.A–C C57B6/L mice were subjected to partial hepatectomy (2/3 PHx) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. D–F C57B6/L mice were injected with acetaminophen (APAP, 300 mg/kg) and sacrificed at indicated time points. Trib1 expression was examined by qPCR, western blotting, and immunohistochemical staining. N = 5 mice for each group. G, H Primary murine hepatocytes were treated with HGF and harvested at indicated time points. Trib1 expression was examined by qPCR and western blotting. N = 3 biological replicates. Data are expressed as mean +/- S.D. *p < 0.05, one-way ANOVA with post-hoc Scheff´e. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37355685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry: TRIB1 Antibody - BSA Free [NBP1-55386] -
Correlation between TRIB1 expression, NRF2 nuclear localization, and hepatocyte proliferation in human ALF specimens.A Human liver biopsy specimens were stained with anti-TRIB1, anti-NRF2, and anti-PCNA. B Linear regression was performed with Graphpad. N = 9. C A schematic model. In quiescent hepatocytes, LXR alpha binds to the Trib1 promoter and activates Trib1 transcription. Trib1 interacts with Nrf2 to sequester Nrf2 in the cytoplasm thus turning off the transcription of antioxidant genes. In proliferating hepatocytes during live regeneration, deactivation of LXR alpha shuts down Trib1 transcription, which unleashes Nrf2 from sequestration. Nrf2 translocates to the nucleus and activates the transcription of antioxidant genes to modulate intracellular redox status fueling cell proliferation. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37355685), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TRIB1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TRIB1
Alternate Names
C8FWG-protein-coupled receptor induced protein, GIG-2, GIG2G-protein-coupled receptor-induced protein 2, G-protein-coupled receptor-induced gene 2 protein, SKIP1, TRB-1, TRB1phosphoprotein regulated by mitogenic pathways, tribbles homolog 1, tribbles homolog 1 (Drosophila), tribbles-like protein 1
Entrez Gene IDs
10221 (Human)
Gene Symbol
TRIB1
UniProt
Additional TRIB1 Products
Product Documents for TRIB1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TRIB1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for TRIB1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TRIB1 Antibody - BSA Free and earn rewards!
Have you used TRIB1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...