TRIB3 Antibody (1H2) - Azide and BSA Free
Novus Biologicals | Catalog # H00057761-M03
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Knockout Validated, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay, Knockdown Validated
Cited:
Western Blot, Proximity Ligation Assay
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 1H2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
TRIB3 (AAH27484, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:33298911) Other species not tested.
Specificity
TRIB3 - tribbles homolog 3 (Drosophila)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Scientific Data Images for TRIB3 Antibody (1H2) - Azide and BSA Free
Western Blot: TRIB3 Antibody (1H2) [H00057761-M03]
Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - Analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M03), clone 1H2. Lane 1: TRIB3 transfected lysatE (39.6 KDa). Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: TRIB3 Antibody (1H2) [H00057761-M03]
Immunocytochemistry/Immunofluorescence: TRIB3 Antibody (1H2) [H00057761-M03] - Analysis of monoclonal antibody to TRIB3 on A-431 cell. Antibody concentration 10 ug/mlWestern Blot: TRIB3 Antibody (1H2) [H00057761-M03]
Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - TRIB3 expression in A-431 ( Cat # L015V1 ).Western Blot: TRIB3 Antibody (1H2) [H00057761-M03]
Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - TRIB3 over-expressed 293 cell line, cotransfected with TRIB3 Validated Chimera RNAi or non-transfected control. Blot probed with H00057761-M03. GAPDH (36.1 kDa) used as loading control.Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] -
Western Blot: TRIB3 Antibody (1H2) [H00057761-M03] - Disturbing the TRIB3/MYC interaction attenuates lymphoma in mice.a The strategy for investigating the anti-BCL effects of PCM4 on MycEμ mice in vivo. b, c The data represent the statistical analyses of spleen & LN weights in MycEμ mice (5 months old; n = 7 per group) treated with the indicated agents. Data are represented as means ± SEM. Statistical significance was determined by two-tailed Student’s t test. P value: 0.016; 0.0108, & 0.0038 (b); 0.003, 0.0003, 7.34 × 10−5 (c). d Representative images of Ki67 staining (left) & statistical analyses of Ki67-positive cells (right) in the spleens of MycEμ mice (5 months old; n = 12 per group) treated with the indicated agents. Scale bar, 50 μm. Data are represented as means ± SEM. Statistical significance was determined by two-tailed Student’s t test. P value: 1.28 × 10−9, 7.86 × 10−10, & 1.13 × 10−9. e The tumorigenicity of BCL cells from the indicated mice was compared by limiting dilution transplantation into NSG mice; n = 8 mice per group. f PCM4 disturbed the TRIB3/MYC interaction in vivo. Spleen lysates from the indicated mice (5 months old) were IP with an anti-TRIB3 Ab & blotted with an anti-MYC Ab. The data are representative of three independent assays. g PCM4-reduced MYC expression. LN & spleen extracts from the indicated mice (5 months old) were blotted with an anti-MYC Ab. The data are presented as representative from three independent experiments. h Kaplan–Meier survival curves for MycEμ BCL mice treated with the indicated agents (n = 10 per group). Statistical difference was determined by two-sided log-rank test. P value: 0.0214 (DOX + PCM4 vs. DOX + PCON). Source data are provided as a Source Data file. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33298911), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TRIB3 Antibody (1H2) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Knockdown Validated
Optimal dilutions of this antibody should be experimentally determined.
Knockout Validated
Optimal dilutions of this antibody should be experimentally determined.
Proximity Ligation Assay
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Use in PLA reported in scientific literature (PMID:33298911).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: TRIB3
Alternate Names
C20orf97, dJ1103G7.3, neuronal cell death inducible putative kinase, Neuronal cell death-inducible putative kinase, NIPK, p65-interacting inhibitor of NF-kappaB, p65-interacting inhibitor of NF-kappa-B, SINK, SKIP3, TRB-3, TRB3chromosome 20 open reading frame 97, tribbles homolog 3, tribbles homolog 3 (Drosophila)
Entrez Gene IDs
57761 (Human)
Gene Symbol
TRIB3
OMIM
607898 (Human)
UniProt
Additional TRIB3 Products
Product Documents for TRIB3 Antibody (1H2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TRIB3 Antibody (1H2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TRIB3 Antibody (1H2) - Azide and BSA Free
Customer Reviews for TRIB3 Antibody (1H2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review TRIB3 Antibody (1H2) - Azide and BSA Free and earn rewards!
Have you used TRIB3 Antibody (1H2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...