TRIM10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85985

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM10. Peptide sequence: LRPEEGVWAVRLAWGFVSALGSFPTRLTLKEQPRQVRVSLDYEVGWVTFT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for TRIM10 Antibody - BSA Free

Western Blot: TRIM10 Antibody [NBP2-85985]

Western Blot: TRIM10 Antibody [NBP2-85985]

Western Blot: TRIM10 Antibody [NBP2-85985] - WB Suggested Anti-TRIM10 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate
Western Blot: TRIM10 Antibody [NBP2-85985]

Western Blot: TRIM10 Antibody [NBP2-85985]

Western Blot: TRIM10 Antibody [NBP2-85985] - WB Suggested Anti-TRIM10 antibody Titration: 1 ug/mL. Sample Type: Human heart

Applications for TRIM10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TRIM10

TRIM10 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells. Alternate splicing of this gene generates two transcript variants encoding different isoforms. [provided by RefSeq]

Alternate Names

B30-RING finger protein, HERF1hematopoietic RING finger 1, RFB30MGC141979, RING finger protein 9, RNF9tripartite motif protein 10, tripartite motif containing 10, tripartite motif-containing 10, tripartite motif-containing protein 10, Zn-finger protein

Gene Symbol

TRIM10

Additional TRIM10 Products

Product Documents for TRIM10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TRIM10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TRIM10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TRIM10 Antibody - BSA Free and earn rewards!

Have you used TRIM10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...