tropomyosin-2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-95197

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human tropomyosin-2 (NP_003280.2). MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for tropomyosin-2 Antibody - Azide and BSA Free

Western Blot: tropomyosin-2 AntibodyAzide and BSA Free [NBP2-95197]

Western Blot: tropomyosin-2 AntibodyAzide and BSA Free [NBP2-95197]

Western Blot: tropomyosin-2 Antibody [NBP2-95197] - Analysis of extracts of various cell lines, using tropomyosin-2 at 1:400 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody [NBP2-95197] - Rat heart using TPM2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody [NBP2-95197] - Human stomach using TPM2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunohistochemistry-Paraffin: tropomyosin-2 Antibody [NBP2-95197] - Mouse heart using TPM2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunoprecipitation: tropomyosin-2 Antibody - Azide and BSA Free [NBP2-95197]

Immunoprecipitation: tropomyosin-2 Antibody [NBP2-95197] - Analysis of 300ug extracts of Mouse skeletal muscle cells using 3ug TPM2 antibody. Western blot was performed from the immunoprecipitate using TPM2 antibody at a dilition of 1:1000.

Applications for tropomyosin-2 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:50-1:100

Immunoprecipitation

0.5μg-4μg antibody for 400μg-600μg extracts of whole cells

Western Blot

1:500-1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: tropomyosin-2

The tropomyosin-2 gene encodes beta-tropomyosin, a member of the actin filament binding protein family, and mainly expressed in slow, type 1 muscle fibers. Mutations in this gene can alter the expression of other sarcomeric tropomyosin proteins, and cause cap disease,

Alternate Names

distal, type 1, tropomyosin 2 (beta)

Gene Symbol

TPM2

Additional tropomyosin-2 Products

Product Documents for tropomyosin-2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for tropomyosin-2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for tropomyosin-2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review tropomyosin-2 Antibody - Azide and BSA Free and earn rewards!

Have you used tropomyosin-2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...