TTC11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37945

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TTC11 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11 (NP_057152.2).

Sequence:
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TTC11 Antibody - BSA Free

TTC11 Antibody

Western Blot: TTC11 Antibody [NBP3-37945] -

Western Blot: TTC11 Antibody [NBP3-37945] - Western blot analysis of various lysates, using [KO Validated] TTC11 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
TTC11 Antibody

Western Blot: TTC11 Antibody [NBP3-37945] -

Western Blot: TTC11 Antibody [NBP3-37945] - Western Blot analysis of extracts from wild type(WT) andTTC11 knockout (KO) HeLa cells, usingTTC11 antibody at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for TTC11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TTC11

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM]

Alternate Names

CGI-135, Fis1, FIS1 homolog, fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae), fission 1 (mitochondrial outer membrane) homolog (yeast), H_NH0132A01.6, hFis1, mitochondrial fission 1 protein, tetratricopeptide repeat domain 11, Tetratricopeptide repeat protein 11, TTC11TPR repeat protein 11

Gene Symbol

FIS1

Additional TTC11 Products

Product Documents for TTC11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TTC11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TTC11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TTC11 Antibody - BSA Free and earn rewards!

Have you used TTC11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies