UbcH7/UBE2L3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92557

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for UbcH7/UBE2L3 Antibody - BSA Free

Western Blot: UbcH7/UBE2L3 Antibody [NBP1-92557]

Western Blot: UbcH7/UBE2L3 Antibody [NBP1-92557]

Western Blot: UbcH7/UBE2L3 Antibody [NBP1-92557] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: UbcH7/UBE2L3 Antibody [NBP1-92557]

Immunohistochemistry-Paraffin: UbcH7/UBE2L3 Antibody [NBP1-92557]

Immunohistochemistry-Paraffin: UbcH7/UBE2L3 Antibody [NBP1-92557] - Staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts.
UbcH7/UBE2L3 Antibody - BSA Free Western Blot: UbcH7/UBE2L3 Antibody - BSA Free [NBP1-92557]

Western Blot: UbcH7/UBE2L3 Antibody - BSA Free [NBP1-92557]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
UbcH7/UBE2L3 Antibody - BSA Free Western Blot: UbcH7/UBE2L3 Antibody - BSA Free [NBP1-92557]

Western Blot: UbcH7/UBE2L3 Antibody - BSA Free [NBP1-92557]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4

Applications for UbcH7/UBE2L3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UbcH7/UBE2L3

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Alternate Names

E2-F1, L-UBC, UBCE7, UbcM4, UBE2L3

Gene Symbol

UBE2L3

Additional UbcH7/UBE2L3 Products

Product Documents for UbcH7/UBE2L3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UbcH7/UBE2L3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UbcH7/UBE2L3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UbcH7/UBE2L3 Antibody - BSA Free and earn rewards!

Have you used UbcH7/UBE2L3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail