UNC84B Antibody (8E8D7)
Novus Biologicals | Catalog # NBP3-15912
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 8E8D7 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 618-717 of human UNC84B (Q9UH99). RIRPTAVTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGKFTYDQDGEPIQTFHFQAPTMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for UNC84B Antibody (8E8D7)
Western Blot: UNC84B Antibody (8E8D7) [NBP3-15912]
Western Blot: UNC84B Antibody (8E8D7) [NBP3-15912] - Western blot analysis of extracts of various cell lines, using UNC84B antibody (NBP3-15912) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 60s.Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] -
Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded human thyroid cancer tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] -
Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded mouse brain tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] -
Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded mouse testis tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] -
Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded rat brain tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] -
Immunohistochemistry: UNC84B Antibody (8E8D7) [NBP3-15912] - Immunohistochemistry analysis of UNC84B in paraffin-embedded Human lung adenocarcinoma tissue using UNC84B Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Applications for UNC84B Antibody (8E8D7)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:1000 - 1:5000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: UNC84B
Alternate Names
FRIGG, KIAA0668, MGC133055, MGC133056, nuclear envelope protein, Protein unc-84 homolog B, Rab5-interacting protein, Rab5IP, Sad1 and UNC84 domain containing 2, Sad1 unc-84 domain protein 2, Sad1/unc-84 protein-like 2, SUN domain-containing protein 2, unc-84 homolog B, unc-84 homolog B (C. elegans), UNC84B
Gene Symbol
SUN2
Additional UNC84B Products
Product Documents for UNC84B Antibody (8E8D7)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for UNC84B Antibody (8E8D7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for UNC84B Antibody (8E8D7)
There are currently no reviews for this product. Be the first to review UNC84B Antibody (8E8D7) and earn rewards!
Have you used UNC84B Antibody (8E8D7)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...