UQCRC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38078

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 224-453 of human UQCRC2 (NP_003357.2).

Sequence:
GVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UQCRC2 Antibody - BSA Free

UQCRC2 Antibody

Immunoprecipitation: UQCRC2 Antibody [NBP3-38078] -

Immunoprecipitation: UQCRC2 Antibody [NBP3-38078] - Immunoprecipitation analysis of 200 ug extracts of HepG2 cells using UQCRC2 antibody. Western blot was performed from the immunoprecipitate using UQCRC2 antibody at a dilution of 1:1000.
UQCRC2 Antibody

Immunohistochemistry: UQCRC2 Antibody [NBP3-38078] -

Immunohistochemistry: UQCRC2 Antibody [NBP3-38078] - Immunohistochemistry analysis of paraffin-embedded Human colon using UQCRC2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
UQCRC2 Antibody

Western Blot: UQCRC2 Antibody [NBP3-38078] -

Western Blot: UQCRC2 Antibody [NBP3-38078] - Western blot analysis of various lysates using UQCRC2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
UQCRC2 Antibody

Immunohistochemistry: UQCRC2 Antibody [NBP3-38078] -

Immunohistochemistry: UQCRC2 Antibody [NBP3-38078] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using UQCRC2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for UQCRC2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UQCRC2

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex),which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex

Alternate Names

Complex III subunit 2, Core protein II, cytochrome b-c1 complex subunit 2, mitochondrial, QCR2, ubiquinol-cytochrome c reductase core protein II, Ubiquinol-cytochrome-c reductase complex core protein 2, UQCR2

Gene Symbol

UQCRC2

Additional UQCRC2 Products

Product Documents for UQCRC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UQCRC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UQCRC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UQCRC2 Antibody - BSA Free and earn rewards!

Have you used UQCRC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...