V-type proton ATPase subunit F Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38942

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for V-type proton ATPase subunit F Antibody - BSA Free

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942] - Staining in human cerebral cortex and skeletal muscle tissues using anti-ATP6V1F antibody. Corresponding ATP6V1F RNA-seq data are presented for the same tissues.
Western Blot: V-type proton ATPase subunit F Antibody [NBP2-38942]

Western Blot: V-type proton ATPase subunit F Antibody [NBP2-38942]

Western Blot: V-type proton ATPase subunit F Antibody [NBP2-38942] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942]

Immunohistochemistry-Paraffin: V-type proton ATPase subunit F Antibody [NBP2-38942] - Staining of human skeletal muscle shows low expression as expected.

Applications for V-type proton ATPase subunit F Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: V-type proton ATPase subunit F

V-type proton ATPase subunit F encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is the V1 domain F subunit protein. [provided by RefSeq]

Alternate Names

ATP6S14adenosinetriphosphatase 14k chain, ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F, H(+)-transporting two-sector ATPase, 14kD subunit, MGC117321, MGC126037, MGC126038, vacuolar ATP synthase subunit F, vacuolar proton pump F subunit, Vacuolar proton pump subunit F, VATFATPase, vacuolar, 14 kD, V-ATPase 14 kDa subunit, V-ATPase F subunit, V-ATPase subunit F, Vma7, V-type proton ATPase subunit F

Gene Symbol

ATP6V1F

UniProt

Additional V-type proton ATPase subunit F Products

Product Documents for V-type proton ATPase subunit F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for V-type proton ATPase subunit F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for V-type proton ATPase subunit F Antibody - BSA Free

There are currently no reviews for this product. Be the first to review V-type proton ATPase subunit F Antibody - BSA Free and earn rewards!

Have you used V-type proton ATPase subunit F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...