V1a Vasopressin R/AVPR1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-94637

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 349-418 of human V1a Vasopressin R/AVPR1A (NP_000697.1). MFFSGHLLQDCVQSFPCCQNMKEKFNKEDTDSMSRRQTFYSNNRSPTNSTGMWKDSPKSSKSIKFIPVST

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for V1a Vasopressin R/AVPR1A Antibody - BSA Free

Western Blot: V1a Vasopressin R/AVPR1A AntibodyBSA Free [NBP2-94637]

Western Blot: V1a Vasopressin R/AVPR1A AntibodyBSA Free [NBP2-94637]

Western Blot: V1a Vasopressin R/AVPR1A Antibody [NBP2-94637] - Analysis of extracts of various cell lines, using V1a Vasopressin R/AVPR1A.Exposure time: 60s.
V1a Vasopressin R/AVPR1A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: V1a Vasopressin R/AVPR1A Antibody - BSA Free [NBP2-94637] -

Immunocytochemistry/ Immunofluorescence: V1a Vasopressin R/AVPR1A Antibody - BSA Free [NBP2-94637] - Immunofluorescence analysis of NIH/3T3 cells using V1a Vasopressin R/AVPR1A Rabbit pAb (A8400) at dilution of 1:100. Blue: DAPI for nuclear staining.
V1a Vasopressin R/AVPR1A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: V1a Vasopressin R/AVPR1A Antibody - BSA Free [NBP2-94637] -

Immunocytochemistry/ Immunofluorescence: V1a Vasopressin R/AVPR1A Antibody - BSA Free [NBP2-94637] - Immunofluorescence analysis of C6 cells using V1a Vasopressin R/AVPR1A Rabbit pAb (A8400) at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for V1a Vasopressin R/AVPR1A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: V1a Vasopressin R/AVPR1A

The protein encoded by the AVPR1A gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily ofG-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins whichstimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction andproliferation, platelet aggregation, release of coagulation factor and glycogenolysis. (provided by RefSeq)

Long Name

Arginine Vasopressin Receptor 1A

Alternate Names

AVPR V1a, AVPR1A, V1a VasopressinR, V1aR

Gene Symbol

AVPR1A

Additional V1a Vasopressin R/AVPR1A Products

Product Documents for V1a Vasopressin R/AVPR1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for V1a Vasopressin R/AVPR1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for V1a Vasopressin R/AVPR1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review V1a Vasopressin R/AVPR1A Antibody - BSA Free and earn rewards!

Have you used V1a Vasopressin R/AVPR1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...