VAC14 Antibody (3B2) - Azide and BSA Free
Novus Biologicals | Catalog # H00055697-M03
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, ELISA, Sandwich ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 3B2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
Specificity
Reacts with Vac14 homolog (S. cerevisiae).
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Scientific Data Images for VAC14 Antibody (3B2) - Azide and BSA Free
Western Blot: VAC14 Antibody (3B2) [H00055697-M03]
Western Blot: VAC14 Antibody (3B2) [H00055697-M03] - Analysis of VAC14 expression in transfected 293T cell line by VAC14 monoclonal antibody (M03), clone 3B2. Lane 1: VAC14 transfected lysate (Predicted MW: 88 KDa). Lane 2: Non-transfected lysate.
Sandwich ELISA: VAC14 Antibody (3B2) [H00055697-M03] - Detection limit for recombinant GST tagged VAC14 is 0.1 ng/ml as a capture antibody.
Applications for VAC14 Antibody (3B2) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: VAC14
Alternate Names
ArPIKfyve, FLJ10305, FLJ36622, MGC149816, protein VAC14 homolog, Tax1 (human T-cell leukemia virus type I) binding protein 1, Tax1 (human T-cell leukemia virus type I) binding protein 2, Tax1-binding protein 2, TAX1BP2FLJ46582, TRXMGC149815, Vac14 homolog (S. cerevisiae)
Entrez Gene IDs
55697 (Human)
Gene Symbol
VAC14
UniProt
Additional VAC14 Products
Product Documents for VAC14 Antibody (3B2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for VAC14 Antibody (3B2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for VAC14 Antibody (3B2) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review VAC14 Antibody (3B2) - Azide and BSA Free and earn rewards!
Have you used VAC14 Antibody (3B2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...