Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)

Novus Biologicals | Catalog # NBP3-16947

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Validated by

Biological Validation

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6O6T6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A phospho specific peptide corresponding to residues surrounding S79/S82/S84 of human Vang-like Protein 2/VANGL2. RDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDC

Modification

p Ser 79, p Ser 82, p Ser 84

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images

Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (5N5B3) [NBP3-16947] - Western blot analysis of extracts of HeLa cells, using Vang-like Protein 2/VANGL2 antibody (NBP3-16947) at 1:1000 dilution.HeLa cells were treated by wnt(100ng/ml) for 30 minutes. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)

Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6) [NBP3-16947] -

Western Blot: Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6) [NBP3-16947] - Western blot analysis of various lysates using Vang-like Protein 2/VANGL2 Rabbit mAb at1:1000 dilution. HeLa and C6 cells were treated by wnt(100ng/ml) for 30 minutes.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Vang-like Protein 2/VANGL2

VANGL2 is involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. It plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. It is required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process. The VANGL2 gene encodes a homolog of Drosophila 'strabismus/Van Gogh' (Stbm/Vang), a component of the frizzled-dishevelled tissue polarity pathway.[supplied by OMIM]

Alternate Names

LPP1, LTAP, STB1, STBM, Strabismus, Vang like Protein 2, VANGL2

Gene Symbol

VANGL2

Additional Vang-like Protein 2/VANGL2 Products

Product Documents

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews

There are currently no reviews for this product. Be the first to review Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6) and earn rewards!

Have you used Vang-like Protein 2/VANGL2 [p Ser84, p Ser79, p Ser82] Antibody (6O6T6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...