Key Product Details
Species Reactivity
Validated:
Predicted:
Applications
Label
Antibody Source
Product Specifications
Immunogen
Reactivity Notes
Localization
Clonality
Host
Isotype
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for VDAC2 Antibody
Western Blot: VDAC2 Antibody [NBP2-20850]
Western Blot: VDAC2 Antibody [NBP2-20850] - Sample (30 ug of whole cell lysate) A: HepG2 B: HCT116 12% SDS PAGE gel, diluted at 1:1000.Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850]
Immunohistochemistry-Paraffin: VDAC2 Antibody [NBP2-20850] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:250 dilution.Western Blot: VDAC2 Antibody [NBP2-20850] -
Western Blot: VDAC2 Antibody [NBP2-20850] - Various tissue extracts (50 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with VDAC2 antibody [N1C2] (NBP2-20850) diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.Applications for VDAC2 Antibody
Immunohistochemistry
Immunohistochemistry-Paraffin
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Preservative
Concentration
Shipping
Stability & Storage
Background: VDAC2
Alternate Names
Gene Symbol
UniProt
Additional VDAC2 Products
Product Documents for VDAC2 Antibody
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for VDAC2 Antibody
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information go to www.P65Warnings.ca.gov.Customer Reviews for VDAC2 Antibody
There are currently no reviews for this product. Be the first to review VDAC2 Antibody and earn rewards!
Have you used VDAC2 Antibody?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for VDAC2 Antibody
-
Q: Could you tell me if this antibody has a chance to recognize the sea urchin sequence according to the amino acid identity with the immunogen? Here is the sequence of the sea urchin VDAC2: MAVPSSYSDLGKAARDIFGKGFGFGFVKLDAKTTTSNNVGFTVSSASNNDTGKVDASLETKYSWKE
A: unfortunately, it does not look like we have any VDAC2 antibodies that I would recommend for use in sea urchin. A majority of our VDAC2 antibodies are made to the human sequence, which only shares 66% homology with the sea urchin sequence. While there are small spans of homology, I do not believe there is enough for recognition.