VDAC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80069

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for VDAC3 Antibody - BSA Free

Western Blot: VDAC3 Antibody [NBP1-80069]

Western Blot: VDAC3 Antibody [NBP1-80069]

Western Blot: VDAC3 Antibody [NBP1-80069] - RPMI-8226, Antibody Dilution: 1.0 ug/ml.
Western Blot: VDAC3 Antibody [NBP1-80069]

Western Blot: VDAC3 Antibody [NBP1-80069]

Western Blot: VDAC3 Antibody [NBP1-80069] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: VDAC3 Antibody [NBP1-80069]

Western Blot: VDAC3 Antibody [NBP1-80069]

Western Blot: VDAC3 Antibody [NBP1-80069] - HT1080, Antibody Dilution: 1.0 ug/ml.

Applications for VDAC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: VDAC3

The Voltage-Dependant Anion Channel (VDAC3) of the outer mitochondrial membrane, a small abundant protein found in all eukaryotic kingdoms, forms a voltage-gated pore when incorporated into planar lipid bilayers. VDAC is also the site of binding of the metabolic enzymes hexokinase and glycerol kinase to the mitochondrion in what may be a significant metabolic regulatory interaction. VDAC3 is involved specifically in translocation of adenine nucleotides through the outer membrane.

Alternate Names

HD-VDAC3, hVDAC3, Outer mitochondrial membrane protein porin 3, VDAC-3, voltage-dependent anion channel 3, voltage-dependent anion-selective channel protein 3

Gene Symbol

VDAC3

Additional VDAC3 Products

Product Documents for VDAC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for VDAC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for VDAC3 Antibody - BSA Free

Customer Reviews for VDAC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review VDAC3 Antibody - BSA Free and earn rewards!

Have you used VDAC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...