WHIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90030

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for WHIP Antibody - BSA Free

Western Blot: WHIP Antibody [NBP1-90030]

Western Blot: WHIP Antibody [NBP1-90030]

Western Blot: WHIP Antibody [NBP1-90030] - Analysis using Anti-WRNIP1 antibody NBP1-90030 (A) shows similar pattern to independent antibody NBP2-38190 (B).
WHIP Antibody - BSA Free Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Staining of human liver shows no positivity in hepatocytes as expected.
WHIP Antibody - BSA Free Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
WHIP Antibody - BSA Free Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Staining of human prostate shows moderate nuclear positivity in glandular cells.
WHIP Antibody - BSA Free Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
WHIP Antibody - BSA Free Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Immunohistochemistry-Paraffin: WHIP Antibody [NBP1-90030]

Staining of human cerebral cortex, liver, placenta and prostate HPA031752 (A) shows similar protein distribution across tissues to independent antibody HPA031753 (B).

Applications for WHIP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: WHIP

Werner's syndrome is a rare autosomal recessive disorder characterized by premature aging. The protein encoded by this gene interacts with the N-terminal portion of Werner protein containing the exonuclease domain. This protein shows homology to replication factor C family proteins, and is conserved from E. coli to human. Studies in yeast suggest that this gene may influence the aging process. Two transcript variants encoding different isoforms have been isolated for this gene.

Alternate Names

ATPase WRNIP1, bA420G6.2, EC 3.6.1, FLJ22526, putative helicase RUVBL, Werner helicase interacting protein 1, Werner helicase-interacting protein 1, WHIPRP11-420G6.2

Gene Symbol

WRNIP1

Additional WHIP Products

Product Documents for WHIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WHIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for WHIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review WHIP Antibody - BSA Free and earn rewards!

Have you used WHIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...