WSTF Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP3-25235PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WSTF

Source: E.coli

Amino Acid Sequence: LVDTPEGLPNTLFGDVAMVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLLQDEIAEDYGELGMKLSEIPLTLHSVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25235It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP3-25235PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: WSTF

The Williams Syndrome Transcription Factor (WSTF), the product of the WBSCR9 gene, is invariably deleted in the haploinsufficiency Williams-Beuren Syndrome. Along with the nucleosome-dependent ATPase ISWI, WSTF forms a novel chromatin remodeling complex, WICH (WSTF-ISWI chromatin remodeling complex). WSTF binds stably to mitotic chromosomes. As dysfunction of other chromatin remodeling factors often has severe effects on development, haploinsufficiency of WSTF may explain some of the phenotypes associated with this disease (1). Evidence has shown that the WSTF is targeted to replication foci through direct interaction with the DNA clamp PCNA, an important coordinator of DNA and chromatin replication. WSTF, in turn, recruits ISWI-type nucleosome-remodelling factor SNF2H to replication sites. It has been proposed that the WSTF-ISWI complex has a role in the maintenance of chromatin structures during DNA replication (2).

Alternate Names

bromodomain adjacent to zinc finger domain, 1B, williams-Beuren syndrome chromosomal region 10 protein

Gene Symbol

BAZ1B

Additional WSTF Products

Product Documents for WSTF Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for WSTF Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for WSTF Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review WSTF Recombinant Protein Antigen and earn rewards!

Have you used WSTF Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...