XRCC6BP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35282

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human XRCC6BP1 (NP_150592.1).

Sequence:
MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for XRCC6BP1 Antibody - BSA Free

XRCC6BP1 Antibody

Western Blot: XRCC6BP1 Antibody [NBP3-35282] -

Western Blot: XRCC6BP1 Antibody [NBP3-35282] - Western blot analysis of various lysates using XRCC6BP1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
XRCC6BP1 Antibody

Western Blot: XRCC6BP1 Antibody [NBP3-35282] -

Western Blot: XRCC6BP1 Antibody [NBP3-35282] - Western Blot analysis of various lysates using XRCC6BP1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
XRCC6BP1 Antibody

Immunohistochemistry: XRCC6BP1 Antibody [NBP3-35282] -

Immunohistochemistry: XRCC6BP1 Antibody [NBP3-35282] - Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using XRCC6BP1 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
XRCC6BP1 Antibody

Immunohistochemistry: XRCC6BP1 Antibody [NBP3-35282] -

Immunohistochemistry: XRCC6BP1 Antibody [NBP3-35282] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using XRCC6BP1 Rabbit pAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for XRCC6BP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:3000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: XRCC6BP1

Alternate Names

EC 3.4.24, EC 3.4.24.-, Ku70-binding protein 3, KUB3Ku70 binding protein 3, MGC134817, MGC134818, mitochondrial inner membrane protease ATP23 homolog, XRCC6 binding protein 1, XRCC6-binding protein 1

Gene Symbol

ATP23

Additional XRCC6BP1 Products

Product Documents for XRCC6BP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for XRCC6BP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for XRCC6BP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review XRCC6BP1 Antibody - BSA Free and earn rewards!

Have you used XRCC6BP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...