ZFP36L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86903

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZFP36L1. Peptide sequence: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZFP36L1 Antibody - BSA Free

Western Blot: ZFP36L1 Antibody [NBP2-86903]

Western Blot: ZFP36L1 Antibody [NBP2-86903]

Western Blot: ZFP36L1 Antibody [NBP2-86903] - Host: Rabbit. Target Name: ZFP36L1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: ZFP36L1 Antibody [NBP2-86903]

Western Blot: ZFP36L1 Antibody [NBP2-86903]

Western Blot: ZFP36L1 Antibody [NBP2-86903] - Host: Rabbit. Target Name: ZFP36L1. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Western Blot: ZFP36L1 Antibody [NBP2-86903]

Western Blot: ZFP36L1 Antibody [NBP2-86903]

Western Blot: ZFP36L1 Antibody [NBP2-86903] - Host: Rabbit. Target: ZFP36L1. Positive control (+): MCF7 (N10). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml

Applications for ZFP36L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZFP36L1

ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.

Alternate Names

ZBRK1KRAB zinc finger protein ZFQR, ZFQR, Zinc finger and BRCA1-interacting protein with a KRAB domain 1, zinc finger protein 350, Zinc finger protein ZBRK1, zinc-finger protein ZBRK1

Gene Symbol

ZFP36L1

Additional ZFP36L1 Products

Product Documents for ZFP36L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZFP36L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZFP36L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZFP36L1 Antibody - BSA Free and earn rewards!

Have you used ZFP36L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...