ZNF416 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05072

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ZNF416 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 495-594 of human ZNF416 (NP_060349.1). ECSECGKFFRQSYTLVEHQKIHTGLRPYDCGQCGKSFIQKSSLIQHQVVHTGERPYECGKCGKSFTQHSGLILHRKSHTVERPRDSSKCGKPYSPRSNIV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZNF416 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of U-2 OS cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunohistochemistry-Paraffin: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded human lung cancer using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of C6 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunocytochemistry/ Immunofluorescence: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunocytochemistry/Immunofluorescence: ZNF416 Antibody [NBP3-05072] - Analysis of NIH-3T3 cells using ZNF416 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunohistochemistry-Paraffin: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded rat pancreas using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunohistochemistry-Paraffin: ZNF416 Antibody - Azide and BSA Free [NBP3-05072]

Immunohistochemistry-Paraffin: ZNF416 Antibody [NBP3-05072] - Immunohistochemistry of paraffin-embedded mouse brain using ZNF416 antibody (NBP3-05072) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for ZNF416 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZNF416

ZNF416 may be involved in transcriptional regulation

Alternate Names

FLJ12859, FLJ14378, GC-box-binding zinc finger protein 1, GZP1, Transcription factor ZBP-99, ZBP99, ZBP-99, Zinc finger DNA-binding protein 99, zinc finger protein 281, ZNP-99, ZNP-99 transcription factor

Gene Symbol

ZNF416

Additional ZNF416 Products

Product Documents for ZNF416 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF416 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ZNF416 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ZNF416 Antibody - Azide and BSA Free and earn rewards!

Have you used ZNF416 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies